General Information

  • ID:  hor006070
  • Uniprot ID:  Q9UHG2
  • Protein name:  Big LEN
  • Gene name:  PCSK1N
  • Organism:  Homo sapiens (Human)
  • Family:  NA
  • Source:  Human
  • Expression:  Expressed in brain and pancreas.
  • Disease:  Diseases associated with PCSK1N include Amyotrophic Lateral Sclerosis-Parkinsonism/Dementia Complex 1 and Parkinsonism.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004866 endopeptidase inhibitor activity; GO:0004867 serine-type endopeptidase inhibitor activity; GO:0005102 signaling receptor binding
  • GO BP:  GO:0002021 response to dietary excess; GO:0007218 neuropeptide signaling pathway; GO:0009409 response to cold; GO:0016486 peptide hormone processing
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005802 trans-Golgi network; GO:0030141 secretory granule

Sequence Information

  • Sequence:  LETPAPQVPARRLLPP
  • Length:  16(245-260)
  • Propeptide:  MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPAR
  • Signal peptide:  MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALC
  • Modification:  NA
  • Glycosylation:  T3 O-linked (GalNAc...) threonine
  • Mutagenesis:  1-1V->A: Reduces inhibition of PCSK1.; 2-2V->A: Reduces inhibition of PCSK1.

Activity

  • Function:  May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activ
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PCSK1
  • Target Unid:  P29120
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9UHG2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006070_AF2.pdbhor006070_ESM.pdb

Physical Information

Mass: 202282 Formula: C80H135N23O21
Absent amino acids: CDFGHIKMNSWY Common amino acids: P
pI: 10.4 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 6
Hydrophobicity: -34.38 Boman Index: -2234
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 103.75
Instability Index: 12472.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10632593
  • Title:  Identification and characterization of proSAAS, a granin-like neuroendocrine peptide precursor that inhibits prohormone processing.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  11435430
  • Title:  Inhibitory s
  • PubMed ID:  12914799
  • Title:  
  • PubMed ID:  14746899
  • Title:  
  • PubMed ID:  19838169
  • Title:  
  • PubMed ID:  22171320
  • Title:  
  • PubMed ID:  23234360
  • Title: